RetrogeneDB ID: | retro_mputfur_790 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896948.1:2654819..2655030(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSMPUG00000014152 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
| Percent Identity: | 58.67 % |
| Parental protein coverage: | 89.02 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | KKHPSLIPLFVFIGAGGTGAALYVLRLALFN-PDVSWDRKNNPEP-WNKLGPNDQYKFYSVNVDYSKLKK |
| ..H.SLI.L..FIG..GTGAA.Y.L.L.LFN.....W....NPEP..N...PNDQ.KF.SVNV.YSKLKK | |
| Retrocopy | RRHSSLISLIIFIG--GTGAAVYLLCLSLFN<SCICWNEDSNPEP<QNEVCPNDQCKFCSVNVNYSKLKK |
| Parental | EGPDF |
| .G.DF | |
| Retrocopy | KGSDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |