RetrogeneDB ID: | retro_fcat_905 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | B3:66669321..66669567(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSFCAG00000022883 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSFCAG00000024790 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
| Percent Identity: | 90.24 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MLRQIFGQAKKHPSLIPLFIFIGAGGTGAALYVLRLALFNPDVSWDRKNNPEPWNKLGPNDQYKFYSVNV |
| MLRQIF.QAKKH.SLIPLFIFIGAGG.G.ALYVL.LALFNPDVS.DRKNNPEPWN.LGPNDQYKFYSVNV | |
| Retrocopy | MLRQIFSQAKKHRSLIPLFIFIGAGGAGPALYVLLLALFNPDVSCDRKNNPEPWNTLGPNDQYKFYSVNV |
| Parental | DYSKLKKEGPDF |
| .YSKLKKEGPDF | |
| Retrocopy | NYSKLKKEGPDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .11 RPM | 125 .91 RPM |
| SRP017611_kidney | 0 .31 RPM | 136 .55 RPM |
| SRP017611_liver | 0 .10 RPM | 72 .68 RPM |