RetrogeneDB ID: | retro_dnov_301 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_3433:136201..136441(-) | ||
| Located in intron of: | ENSDNOG00000010379 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSDNOG00000009322 | ||
| Aliases: | None | ||
| Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
| Percent Identity: | 90. % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV |
| MSLRKQTPSDFLKQIIG..VVVKLNSGVDY.GVLACLDG..NIALEQTEEYV.GQLKNKYGDAFIRGNNV | |
| Retrocopy | MSLRKQTPSDFLKQIIG*SVVVKLNSGVDY*GVLACLDGSINIALEQTEEYVSGQLKNKYGDAFIRGNNV |
| Parental | LYISTPKRGM |
| LYIST.KR.M | |
| Retrocopy | LYISTQKRKM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 10 .31 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 9 .90 RPM |
| SRP012922_heart | 0 .00 RPM | 6 .50 RPM |
| SRP012922_kidney | 0 .00 RPM | 5 .20 RPM |
| SRP012922_liver | 0 .00 RPM | 3 .10 RPM |
| SRP012922_lung | 0 .00 RPM | 7 .33 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 6 .75 RPM |
| SRP012922_spleen | 0 .00 RPM | 9 .96 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Homo sapiens | ENSG00000164167 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |