RetrogeneDB ID: | retro_btau_861 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 2:25336692..25336932(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSBTAG00000014060 | ||
| Aliases: | None | ||
| Description: | U6 snRNA-associated Sm-like protein LSm6 [Source:RefSeq peptide;Acc:NP_001107991] |
| Percent Identity: | 93.75 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV |
| MSL.KQTPSDFLKQI.GRPVVVKLNSGVDYRGVLACLDGYMNI.LEQTEEYVNGQLKN.YGDAFI.GNNV | |
| Retrocopy | MSLWKQTPSDFLKQITGRPVVVKLNSGVDYRGVLACLDGYMNIVLEQTEEYVNGQLKNTYGDAFIQGNNV |
| Parental | LYISTQKRRM |
| LYISTQKRRM | |
| Retrocopy | LYISTQKRRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .22 RPM | 16 .58 RPM |
| ERP005899_muscle | 0 .11 RPM | 13 .41 RPM |
| SRP017611_brain | 0 .00 RPM | 13 .02 RPM |
| SRP017611_kidney | 0 .00 RPM | 20 .75 RPM |
| SRP017611_liver | 0 .08 RPM | 12 .31 RPM |
| SRP030211_testis | 0 .07 RPM | 20 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014060 | 1 retrocopy |
retro_btau_861 ,
|
| Bos taurus | ENSBTAG00000016271 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Homo sapiens | ENSG00000164167 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |