RetrogeneDB ID: | retro_nleu_1479 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397295.1:7190325..7190564(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSNLEG00000005584 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.29 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | MSLRKQTPSD-FLKQIIGRPVV-VKLNSGVDYRGVLACLDGYMNIALEQTEEYV-NGQLKNKYGDAFIRG |
| MSL.KQT..D..LKQI.G.P.V.VKLNS.VDY.GVLACLDGYMNIAL.Q.EEYV.NGQLKNK.G.AF... | |
| Retrocopy | MSLQKQTSGD<LLKQIMGQPTV>VKLNSAVDY*GVLACLDGYMNIALKQAEEYV<NGQLKNKHGVAFSHR |
| Parental | NNVLYISTQKRRM |
| N.V.YIS.QK.RM | |
| Retrocopy | NHVFYISAQKKRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Homo sapiens | ENSG00000164167 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies |
retro_nleu_1275, retro_nleu_1479 ,
|
| Nomascus leucogenys | ENSNLEG00000005835 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |