RetrogeneDB ID: | retro_mmur_1563 | ||
Retrocopylocation | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | scaffold_8327:136..313(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSMICG00000000571 | ||
| Aliases: | None | ||
| Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
| Percent Identity: | 63.33 % |
| Parental protein coverage: | 75. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | VVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM |
| .....SGVDYR.VLA.LDGYMNIALEQT..Y.NGQ.K...GDAF....N.L.IS..KRRM | |
| Retrocopy | IIXXXSGVDYRRVLAFLDGYMNIALEQTARYINGQVKHNHGDAFL-PENMLCISIEKRRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000000571 | 1 retrocopy |
retro_mmur_1563 ,
|
| Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |