RetrogeneDB ID: | retro_mmul_668 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1099214194767:357..594(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSMMUG00000005524 | ||
| Aliases: | None | ||
| Description: | U6 snRNA-associated Sm-like protein LSm6 [Source:RefSeq peptide;Acc:NP_001253894] |
| Percent Identity: | 69.88 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | MSLRKQTPSD-FLKQIIGRPVVVKLNSG-VDYRGVLACLDGYMNIALEQTEEYV-NGQLKNKYGDAFIRG |
| MSL.KQT..D..LKQI.G.P.VVKLNS..VDYRGVLACLDGYMN.ALEQ.EEY..NGQLKNK.G.A.... | |
| Retrocopy | MSLQKQTSGD<LLKQIMGQPTVVKLNSE<VDYRGVLACLDGYMNTALEQAEEYI<NGQLKNKHGAAISHR |
| Parental | NNVLYISTQKRRM |
| N.V.YI..QK.RM | |
| Retrocopy | NHVFYIGAQKKRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 7 .17 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .62 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .78 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .51 RPM |
| SRP007412_liver | 0 .04 RPM | 7 .88 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies |
retro_mmul_668 , retro_mmul_991,
|
| Macaca mulatta | ENSMMUG00000009302 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |