RetrogeneDB ID: | retro_cjac_1173 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 13:99542805..99543042(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSCJAG00000002482 | ||
| Aliases: | None | ||
| Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
| Percent Identity: | 62.65 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | MSLRKQTPSD-FLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYV-NGQLKNKYGDAFIRGN |
| M.L.KQT..D...KQI.G.P..VKLNS.VDY.G.LACLDGYM..ALEQ.EEYV.N.QLKNK.G.AF..GN | |
| Retrocopy | MGLWKQTSGD<LMKQIMGQPIMVKLNSRVDYQGTLACLDGYMPTALEQAEEYV<NEQLKNKHGSAFNHGN |
| Parental | NVLY-ISTQKRRM |
| ...Y....QK.RM | |
| Retrocopy | QAFY<PRAQKKRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 6 .57 RPM |
| SRP051959_heart | 0 .04 RPM | 5 .79 RPM |
| SRP051959_kidney | 0 .55 RPM | 5 .77 RPM |
| SRP051959_liver | 0 .02 RPM | 6 .41 RPM |
| SRP051959_lung | 0 .08 RPM | 8 .82 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 8 .81 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 5 .24 RPM |
| SRP051959_spleen | 0 .00 RPM | 10 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002705 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |