RetrogeneDB ID: | retro_chof_190 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_426:210743..210959(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SUMO1 | ||
| Ensembl ID: | ENSCHOG00000009739 | ||
| Aliases: | None | ||
| Description: | small ubiquitin-like modifier 1 [Source:HGNC Symbol;Acc:12502] |
| Percent Identity: | 90.54 % |
| Parental protein coverage: | 51.06 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | DSSEIHFKVK-MTTHLK-KLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG |
| DSSEIHFKVK.MT.HLK.KLKE.YCQR.GVPMNSLRFLFEGQRIADNHTPKELGMEEED.IEVYQEQT.G | |
| Retrocopy | DSSEIHFKVK<MTKHLK>KLKELYCQRWGVPMNSLRFLFEGQRIADNHTPKELGMEEEDAIEVYQEQTRG |
| Parental | HSTV |
| HSTV | |
| Retrocopy | HSTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013225 | 5 retrocopies | |
| Bos taurus | ENSBTAG00000009859 | 6 retrocopies | |
| Canis familiaris | ENSCAFG00000012431 | 8 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000009739 | 2 retrocopies |
retro_chof_190 , retro_chof_2068,
|
| Choloepus hoffmanni | ENSCHOG00000010239 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031005 | 6 retrocopies | |
| Loxodonta africana | ENSLAFG00000022855 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007504 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005240 | 7 retrocopies | |
| Mustela putorius furo | ENSMPUG00000000335 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000026021 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006997 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030345 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013083 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000012817 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011968 | 1 retrocopy |