RetrogeneDB ID: | retro_mmul_2081 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 6:53389673..53389966(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMMUG00000030097 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SUMO1 | ||
| Ensembl ID: | ENSMMUG00000005240 | ||
| Aliases: | None | ||
| Description: | small ubiquitin-related modifier 1 [Source:RefSeq peptide;Acc:NP_001182571] |
| Percent Identity: | 95.96 % |
| Parental protein coverage: | 97.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | QEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQ-GVPMNSLRFLFEGQRIA |
| QEAKP.TEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQR..GVPMNSLRFLFE.QRIA | |
| Retrocopy | QEAKPLTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRR<GVPMNSLRFLFESQRIA |
| Parental | DNHTPKELGMEEEDVIEVYQEQTGGHSTV |
| DNHTPKELGMEEEDVIEVYQEQTGGHSTV | |
| Retrocopy | DNHTPKELGMEEEDVIEVYQEQTGGHSTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .03 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 19 .99 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .04 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .59 RPM |
| SRP007412_kidney | 0 .00 RPM | 4 .23 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .75 RPM |
| SRP007412_testis | 0 .04 RPM | 1 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009859 | 6 retrocopies | |
| Canis familiaris | ENSCAFG00000012431 | 8 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000009739 | 2 retrocopies | |
| Felis catus | ENSFCAG00000031005 | 6 retrocopies | |
| Loxodonta africana | ENSLAFG00000022855 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000008968 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007504 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005240 | 7 retrocopies |
retro_mmul_1108, retro_mmul_2035, retro_mmul_2081 , retro_mmul_313, retro_mmul_373, retro_mmul_450, retro_mmul_855,
|
| Macaca mulatta | ENSMMUG00000006760 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006997 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030345 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000006870 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013083 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000012817 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011968 | 1 retrocopy |