RetrogeneDB ID: | retro_pvam_258 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | GeneScaffold_2206:76649..76892(-) | ||
| Located in intron of: | ENSPVAG00000011067 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS12 | ||
| Ensembl ID: | ENSPVAG00000017201 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S12 [Source:HGNC Symbol;Acc:10385] |
| Percent Identity: | 53.66 % |
| Parental protein coverage: | 62.12 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 0 |
| Parental | VLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQA |
| ...SN.D......LVE.LCA.HQINL..V..N.KL...V.L.KI....KP.K.VGCS..VVK...KES.A | |
| Retrocopy | LVPSNRDTTI*KSLVEKLCAKHQINLTEVGHNQKLEK*VDL*KITGIAKPHKAVGCS-MVVKNHSKES*A |
| Parental | KDVIEEYFKCKK |
| ..VI.EYFK.KK | |
| Retrocopy | NYVIQEYFKYKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |