RetrogeneDB ID: | retro_ptro_333 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:116824073..116824403(-) | ||
| Located in intron of: | ENSPTRG00000001194 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PFN1 | ||
| Ensembl ID: | ENSPTRG00000008616 | ||
| Aliases: | None | ||
| Description: | profilin 1 [Source:HGNC Symbol;Acc:8881] |
| Percent Identity: | 76.58 % |
| Parental protein coverage: | 85.38 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | LMADRTCQDAALLGYKDSPSVWAGVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQ |
| LMAD.TC.D.A..G.KDSPS.WA.VPGK.FVNITPAEVGVLVGKD.S.F.VNGLTLGGQK..V..DSLLQ | |
| Retrocopy | LMADGTC*DTAIVGNKDSPSIWAAVPGKIFVNITPAEVGVLVGKDWSNFFVNGLTLGGQKYTVVPDSLLQ |
| Parental | DGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHG |
| DGE...DL..KS.GGAPTFNVTVT.T.KTL.LLMGK.GVHG | |
| Retrocopy | DGELTADLHVKSIGGAPTFNVTVTMTAKTLGLLMGK-GVHG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 85 .21 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 113 .21 RPM |
| SRP007412_heart | 0 .00 RPM | 105 .01 RPM |
| SRP007412_kidney | 0 .00 RPM | 290 .99 RPM |
| SRP007412_liver | 0 .00 RPM | 606 .30 RPM |
| SRP007412_testis | 0 .00 RPM | 52 .16 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_214 |
| Gorilla gorilla | retro_ggor_285 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006193 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000004915 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011719 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000013136 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021116 | 3 retrocopies | |
| Homo sapiens | ENSG00000108518 | 10 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022394 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000002772 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000018293 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017446 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031395 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000000291 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000004124 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008616 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000003975 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017905 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028950 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001299 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000005327 | 3 retrocopies |