RetrogeneDB ID: | retro_mmul_574 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:201372006..201372428(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000023201 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PFN1 | ||
| Ensembl ID: | ENSMMUG00000002772 | ||
| Aliases: | PFN1, profilin-1 | ||
| Description: | Profilin [Source:UniProtKB/TrEMBL;Acc:F7H2A5] |
| Percent Identity: | 69.23 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MAGW-NAYIDNLMAD--GTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLG |
| M.GW..AYIDNLMA.....CQDAAI.GYKDSPS.WAA...KTF..ITPAE..VL.GKDRSS..VNGLTLG | |
| Retrocopy | MDGW<DAYIDNLMAEVPSVCQDAAIMGYKDSPSIWAAISWKTFASITPAEASVLAGKDRSSVFVNGLTLG |
| Parental | GQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRR |
| GQKCSVIRDSLLQDGEF.MDL........P...........TLVLLMGKE.VHGGLINKKCYEM.SH..R | |
| Retrocopy | GQKCSVIRDSLLQDGEFCMDLSIPRVPVEPPLSMSLSPR-LTLVLLMGKESVHGGLINKKCYEMTSHFWR |
| Parental | SQY |
| SQY | |
| Retrocopy | SQY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 35 .07 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 67 .43 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 29 .12 RPM |
| SRP007412_heart | 0 .00 RPM | 90 .62 RPM |
| SRP007412_kidney | 0 .00 RPM | 116 .31 RPM |
| SRP007412_liver | 0 .00 RPM | 304 .16 RPM |
| SRP007412_testis | 0 .04 RPM | 35 .43 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Callithrix jacchus | retro_cjac_1641 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006193 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000004915 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011719 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000013136 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021116 | 3 retrocopies | |
| Homo sapiens | ENSG00000108518 | 10 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022394 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000002772 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000018293 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017446 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031395 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000000291 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000004124 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008616 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000003975 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017905 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028950 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001299 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000005327 | 3 retrocopies |