RetrogeneDB ID: | retro_ptro_2190 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 5:133604189..133604412(+) | ||
| Located in intron of: | ENSPTRG00000017228 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSPTRG00000017538 | ||
| Aliases: | ATP6V0E1, ATP6V0E | ||
| Description: | None |
| Percent Identity: | 72.5 % |
| Parental protein coverage: | 97.53 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | YHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCY-LFWLIAILAQLNPLFGPQLKNE |
| YHGLT....V.S.FWGFVGF.VP.F.PK.PN.GVIITM.VTCSV.C..LFWLIAILAQ.NPL..P.LK.E | |
| Retrocopy | YHGLT----VTSMFWGFVGFFVP*FVPKRPNWGVIITMMVTCSV-CH>LFWLIAILAQCNPLYRP*LKDE |
| Parental | TIWYLKYHWP |
| T.WYLK.HWP | |
| Retrocopy | TTWYLKHHWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 18 .36 RPM |
| SRP007412_cerebellum | 0 .14 RPM | 11 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 43 .57 RPM |
| SRP007412_kidney | 0 .00 RPM | 127 .49 RPM |
| SRP007412_liver | 0 .03 RPM | 76 .93 RPM |
| SRP007412_testis | 0 .00 RPM | 26 .87 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3240 |
| Gorilla gorilla | retro_ggor_2206 |
| Pongo abelii | retro_pabe_2688 |
| Callithrix jacchus | retro_cjac_1923 |