RetrogeneDB ID: | retro_mmul_1446 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 2:94733962..94734205(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.1266 | ||
| Ensembl ID: | ENSMMUG00000013825 | ||
| Aliases: | ATP6V0E1, ATP6V0E | ||
| Description: | V-type proton ATPase subunit e 1 [Source:RefSeq peptide;Acc:NP_001248055] |
| Percent Identity: | 75.31 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAYQGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN |
| MAY.GL.VPL.VMS.FWGFVGFLVPW.IP.GP..GVIIT.LVTC.V.C.LFWLI..L.QLNPL.GPQLKN | |
| Retrocopy | MAYHGLMVPLTVMSMFWGFVGFLVPWLIPTGPYWGVIITTLVTCPVFCCLFWLISVLSQLNPLCGPQLKN |
| Parental | ETIWYLKYHWP |
| E.IW.LK..WP | |
| Retrocopy | EAIWCLKHRWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 18 .94 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 11 .50 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .59 RPM |
| SRP007412_heart | 0 .00 RPM | 50 .17 RPM |
| SRP007412_kidney | 0 .00 RPM | 127 .81 RPM |
| SRP007412_liver | 0 .00 RPM | 108 .18 RPM |
| SRP007412_testis | 0 .08 RPM | 14 .89 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pongo abelii | retro_pabe_2236 |