RetrogeneDB ID: | retro_ggor_1937 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 3:42896770..42897010(-) | ||
| Located in intron of: | ENSGGOG00000001842 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSGGOG00000006701 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.25 % |
| Parental protein coverage: | 98.77 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AYHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNE |
| AYHGL.VP..VMS.FWGFVGFLVPWFIPKGP...VIIT.LVTC.V.CYLFWLI.ILAQLNPLFGPQL.NE | |
| Retrocopy | AYHGLMVPFAVMSMFWGFVGFLVPWFIPKGPYWEVIITILVTCPVFCYLFWLISILAQLNPLFGPQLTNE |
| Parental | TIWYLKYHWP |
| ..WYLK.HWP | |
| Retrocopy | AVWYLKHHWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 13 .76 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 14 .89 RPM |
| SRP007412_heart | 0 .06 RPM | 20 .08 RPM |
| SRP007412_kidney | 0 .33 RPM | 135 .34 RPM |
| SRP007412_liver | 0 .11 RPM | 75 .28 RPM |
| SRP007412_testis | 0 .10 RPM | 48 .59 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2780 |
| Pan troglodytes | retro_ptro_1881 |