RetrogeneDB ID: | retro_chof_718 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_139505:1697..1912(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSCHOG00000004421 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 [Source:HGNC Symbol;Acc:863] |
| Percent Identity: | 53.95 % |
| Parental protein coverage: | 92.59 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LTVPLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPL-FGPQLKNETIW |
| L..PL.VMSV...F.G..........P.........VTC.VCC.LF.LI.ILA.LNPL...PQ.KNETIW | |
| Retrocopy | LVDPLTVMSV---FLGFVGLFVLGSSPRGLTGDDL*VTCLVCCPLFLLIIILAELNPL<LRPQMKNETIW |
| Parental | YLKYHW |
| YLKYHW | |
| Retrocopy | YLKYHW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |