RetrogeneDB ID: | retro_cfam_1961 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 8:44002034..44002277(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCAFG00000016617 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSCAFG00000031898 | ||
| Aliases: | ATP6V0E1, ATP6H, ATP6V0E | ||
| Description: | Canis lupus familiaris ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 (ATP6V0E1), mRNA. [Source:RefSeq mRNA;Acc:NM_001003128] |
| Percent Identity: | 97.53 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAYNGLTVPLIVMSVFWGFVGFCVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN |
| MAYNGLTVPLI..SVFWGFVGFCVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN | |
| Retrocopy | MAYNGLTVPLIMISVFWGFVGFCVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN |
| Parental | ETIWYLKYHWP |
| ETIWYLKYHWP | |
| Retrocopy | ETIWYLKYHWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .04 RPM | 11 .21 RPM |
| SRP017611_brain | 0 .16 RPM | 8 .73 RPM |
| SRP017611_kidney | 3 .50 RPM | 166 .22 RPM |
| SRP017611_liver | 0 .15 RPM | 20 .74 RPM |