RetrogeneDB ID: | retro_pabe_2084 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 2b:113486726..113486921(+) | ||
| Located in intron of: | ENSPPYG00000013217 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000007915 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.62 % |
| Parental protein coverage: | 57.52 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAGPAAAFRRLGALSGAAALGFASYGAHGAQFPDAYGEELFDKANKHHFLHSLALLGVPHCRKPL |
| .AGP.AAF..LG.LS.A.ALG..S.G.H..QF.DAY..ELFD.AN.HHF.HSLALL...HCR.PL | |
| Retrocopy | LAGPGAAFCHLGTLSVAGALGLTS*GVHTTQFLDAYWKELFDTANAHHFSHSLALLRGLHCRRPL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .76 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 2 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .91 RPM |
| SRP007412_kidney | 0 .00 RPM | 14 .02 RPM |
| SRP007412_liver | 0 .00 RPM | 16 .43 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2212 |
| Pan troglodytes | retro_ptro_1678 |
| Gorilla gorilla | retro_ggor_1745 |
| Macaca mulatta | retro_mmul_929 |