RetrogeneDB ID: | retro_btau_532 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 13:62401853..62402053(-) | ||
| Located in intron of: | ENSBTAG00000031402 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C19H17orf61 | ||
| Ensembl ID: | ENSBTAG00000031752 | ||
| Aliases: | TMEM256, C17orf61, C19H17orf61 | ||
| Description: | UPF0451 protein C17orf61 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q2KI29] |
| Percent Identity: | 88.24 % |
| Parental protein coverage: | 59.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MAGPGAAFRRLGALSGAGALGLASYGAHGAQFPDAYGKELFDKTNKHHFLHSLA-LLAVPLCRKPLWA |
| MAGPGAAFRRL.ALSGAGALGLASYGAH.AQFP.AYGKELFDK.NKHHFLHSLA.L..V.LCRKPLWA | |
| Retrocopy | MAGPGAAFRRLDALSGAGALGLASYGAHRAQFPNAYGKELFDKSNKHHFLHSLA<LVVVSLCRKPLWA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 18 .24 RPM |
| ERP005899_muscle | 0 .16 RPM | 33 .47 RPM |
| SRP017611_brain | 0 .14 RPM | 11 .69 RPM |
| SRP017611_kidney | 0 .12 RPM | 35 .44 RPM |
| SRP017611_liver | 0 .00 RPM | 14 .50 RPM |
| SRP030211_testis | 0 .04 RPM | 4 .90 RPM |