RetrogeneDB ID: | retro_ocun_311 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 1:138536076..138536427(+) | ||
| Located in intron of: | ENSOCUG00000021262 | ||
Retrocopy information | Ensembl ID: | ENSOCUG00000005752 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GABARAP | ||
| Ensembl ID: | ENSOCUG00000006997 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptor-associated protein (GABARAP), mRNA [Source:RefSeq mRNA;Acc:NM_001082142] |
| Percent Identity: | 97.44 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
| MKFVYKEEHPFEKRRSEGEKIRKKY.DRVPVIVEKAPKARIGD.DKKKYLVPSDLTVGQFYFLIRKRIHL | |
| Retrocopy | MKFVYKEEHPFEKRRSEGEKIRKKYTDRVPVIVEKAPKARIGDMDKKKYLVPSDLTVGQFYFLIRKRIHL |
| Parental | RAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| .AEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL | |
| Retrocopy | QAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .39 RPM | 180 .74 RPM |
| SRP017611_kidney | 0 .30 RPM | 317 .96 RPM |
| SRP017611_liver | 0 .31 RPM | 108 .68 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000018567 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy |
retro_ocun_311 ,
|
| Oryctolagus cuniculus | ENSOCUG00000016834 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000022970 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0052672 | 1 retrocopy |