RetrogeneDB ID: | retro_rnor_1818 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 3:118207284..118207602(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Gabarap | ||
| Ensembl ID: | ENSRNOG00000017417 | ||
| Aliases: | None | ||
| Description: | Gamma-aminobutyric acid receptor-associated protein [Source:UniProtKB/Swiss-Prot;Acc:P60517] |
| Percent Identity: | 92.45 % |
| Parental protein coverage: | 89.74 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
| MKF.YKEEHPFEKRRSEGEKI.KKYPDRVPVIVEKAPKARIGDLDKKKYL.PSDLTVGQFYFLIRKRIHL | |
| Retrocopy | MKFMYKEEHPFEKRRSEGEKI*KKYPDRVPVIVEKAPKARIGDLDKKKYLLPSDLTVGQFYFLIRKRIHL |
| Parental | RAEDALFFFVNNVIPPTSATMGQLYQE-HHEEDFFL |
| .AEDALFFFVNN.I.P.SATMGQLYQE.HHEEDFFL | |
| Retrocopy | CAEDALFFFVNNAISPISATMGQLYQEQHHEEDFFL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .07 RPM | 74 .84 RPM |
| SRP017611_kidney | 0 .00 RPM | 190 .92 RPM |
| SRP017611_liver | 0 .00 RPM | 96 .69 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000018567 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies |
retro_rnor_1818 , retro_rnor_2093,
|
| Rattus norvegicus | ENSRNOG00000017905 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0052672 | 1 retrocopy |