RetrogeneDB ID: | retro_cjac_3820 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | GL284785.1:20880..21225(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000022353 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GABARAP | ||
| Ensembl ID: | ENSCJAG00000016655 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptor-associated protein [Source:HGNC Symbol;Acc:4067] |
| Percent Identity: | 88.89 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
| .KFVYKEEHPFEK.RSEG.K..KKYPDRV..IVEKAPK.RIGDLDKKKYLVPS.LTVGQFYFLIRKRIHL | |
| Retrocopy | IKFVYKEEHPFEKLRSEGQKNLKKYPDRVQMIVEKAPKVRIGDLDKKKYLVPSVLTVGQFYFLIRKRIHL |
| Parental | RAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| R.EDALFFFVNNVIPPT..TMGQLYQEHHEE.FFLYIAYSDESVYGL | |
| Retrocopy | RSEDALFFFVNNVIPPT--TMGQLYQEHHEEEFFLYIAYSDESVYGL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 11 .00 RPM |
| SRP051959_heart | 0 .00 RPM | 17 .10 RPM |
| SRP051959_kidney | 0 .00 RPM | 19 .44 RPM |
| SRP051959_liver | 0 .00 RPM | 14 .06 RPM |
| SRP051959_lung | 0 .02 RPM | 15 .26 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 10 .23 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 28 .48 RPM |
| SRP051959_spleen | 0 .02 RPM | 18 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004473 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies |
retro_cjac_2851, retro_cjac_3820 ,
|
| Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000018567 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0052672 | 1 retrocopy |