RetrogeneDB ID: | retro_mputfur_1124 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897021.1:4670257..4670499(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS15A | ||
| Ensembl ID: | ENSMPUG00000013424 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S15a [Source:HGNC Symbol;Acc:10389] |
| Percent Identity: | 53.66 % |
| Parental protein coverage: | 62.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KRQVLIRPCSKVI-VRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQ |
| ..Q.L.R.CS.V...R..TV..KHGY.GE....DD..AG...VNL.GRL..C...SP..D..LKDLEK.Q | |
| Retrocopy | EHQALTRSCSEVL<LRLPTVTTKHGYTGEVDAPDDYGAGETAVNLAGRLHECAGMSPGSDLRLKDLEKRQ |
| Parental | NNLLPSRQFGFI |
| N.LL.S.Q.GFI | |
| Retrocopy | NHLLLSQQSGFI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |