RetrogeneDB ID: | retro_mmus_1229 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 14:108672313..108672548(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H2afv | ||
| Ensembl ID: | ENSMUSG00000041126 | ||
| Aliases: | H2afv, C530002L11Rik, H2a.z-2, H2av | ||
| Description: | H2A histone family, member V [Source:MGI Symbol;Acc:MGI:1924855] |
| Percent Identity: | 51.85 % |
| Parental protein coverage: | 62.5 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKAT-IAGGGVIPHIH |
| V..T.......I...L....L.L.GNASKD.KV..I...HLQ.AI.GD.ELD.LIKA....GG.VIPH.. | |
| Retrocopy | VDVTNICFGTDIISTLVIKLLALSGNASKDVKVNCISTGHLQPAIHGDKELDYLIKAN>AGGG-VIPHT- |
| Parental | KSLIGKKGQQK |
| ..LIGKKGQ.. | |
| Retrocopy | INLIGKKGQEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 20 .79 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 25 .88 RPM |
| SRP007412_heart | 0 .00 RPM | 38 .48 RPM |
| SRP007412_kidney | 0 .00 RPM | 35 .25 RPM |
| SRP007412_liver | 0 .00 RPM | 23 .95 RPM |
| SRP007412_testis | 0 .00 RPM | 17 .24 RPM |