RetrogeneDB ID: | retro_sscr_152 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:32397699..32398064(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H2AFV | ||
| Ensembl ID: | ENSSSCG00000016738 | ||
| Aliases: | None | ||
| Description: | H2A histone family, member V [Source:HGNC Symbol;Acc:20664] |
| Percent Identity: | 73.6 % |
| Parental protein coverage: | 97.64 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNAS |
| KA.KD.GK.K.KA.SRSQRA.LQFPVG.IH..LK..TTSHG..GATA.VYSA.IL...T.EV.ELAGNAS | |
| Retrocopy | KAWKDFGKSKTKAGSRSQRASLQFPVGHIH*PLKSQTTSHGCMGATASVYSADILKNITPEVFELAGNAS |
| Parental | KDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK-KGQQKTA |
| K.LKV..ITP.HLQLAIRG...LD.LIKAT.AGGGVIPHIHKSL.G..KGQQK.A | |
| Retrocopy | KNLKVMCITPHHLQLAIRG-KVLDYLIKATVAGGGVIPHIHKSL-GR<KGQQKSA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 58 .14 RPM |
| SRP014902_testis | 0 .00 RPM | 111 .04 RPM |
| SRP018288_heart | 0 .00 RPM | 52 .91 RPM |
| SRP018288_kidney | 0 .00 RPM | 140 .57 RPM |
| SRP018288_liver | 0 .00 RPM | 57 .25 RPM |
| SRP018288_lung | 0 .00 RPM | 39 .92 RPM |
| SRP018856_adipose | 0 .00 RPM | 76 .61 RPM |
| SRP035408_brain | 0 .00 RPM | 19 .63 RPM |
| SRP035408_liver | 0 .00 RPM | 49 .02 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000889 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011953 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000769 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000000793 | 5 retrocopies | |
| Homo sapiens | ENSG00000105968 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014500 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000041126 | 2 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000009378 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008133 | 10 retrocopies | |
| Otolemur garnettii | ENSOGAG00000025145 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015604 | 3 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000005931 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000019153 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000007026 | 5 retrocopies | |
| Sus scrofa | ENSSSCG00000016738 | 1 retrocopy |
retro_sscr_152 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000011533 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013840 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000004507 | 1 retrocopy |