RetrogeneDB ID: | retro_mmul_1920 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 5:151183746..151183973(+) | ||
| Located in intron of: | ENSMMUG00000003488 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2121 | ||
| Ensembl ID: | ENSMMUG00000000486 | ||
| Aliases: | None | ||
| Description: | fatty acid-binding protein, epidermal [Source:RefSeq peptide;Acc:NP_001247718] |
| Percent Identity: | 75.32 % |
| Parental protein coverage: | 56.3 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LKTTQFSCTLGEKFEETTADGRKTQTVCSFTDGALVQHQ-EWDGKESTITRKLKDGKLVVDCVMNNVTCT |
| L...QFSCTLGEK..ETTA..RK.Q..C.FTDGALVQH..EWDGK.STI.RKLKDGK.VVDCVM.NVTC. | |
| Retrocopy | LRKQQFSCTLGEKSVETTARSRKSQILCNFTDGALVQHR<EWDGKKSTIIRKLKDGKFVVDCVMHNVTCS |
| Parental | RIYEKVE |
| RIY.KVE | |
| Retrocopy | RIYKKVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 8 .85 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .23 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .17 RPM |
| SRP007412_heart | 0 .00 RPM | 44 .69 RPM |
| SRP007412_kidney | 0 .00 RPM | 4 .46 RPM |
| SRP007412_liver | 0 .00 RPM | 2 .10 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .29 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3000 |
| Pan troglodytes | retro_ptro_2029 |
| Gorilla gorilla | retro_ggor_2079 |
| Callithrix jacchus | retro_cjac_2227 |