RetrogeneDB ID: | retro_btau_1828 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | X:79688099..79688319(-) | ||
| Located in intron of: | ENSBTAG00000038434 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP5 | ||
| Ensembl ID: | ENSBTAG00000047330 | ||
| Aliases: | None | ||
| Description: | Fatty acid-binding protein, epidermal [Source:UniProtKB/TrEMBL;Acc:G3N269] |
| Percent Identity: | 50.67 % |
| Parental protein coverage: | 54.81 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | ESKGFDEYMKEVGVGLSVRRPTSACKPVIMIKSAGKYIDYKTEST-LKTTQFSCKLGEKFEETTADGRKT |
| .SK....Y.K.V.VGL.........KP...I.S.......K.E.T.LKT.QFS.KL.EKFEETTA.GRK. | |
| Retrocopy | KSKDVEGYIKAV*VGLAL*KMDAVVKPDYVITSDSESLTIKIECT>LKT-QFS*KLEEKFEETTAVGRKP |
| Parental | QTVCN |
| QTV.N | |
| Retrocopy | QTVFN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 0 .79 RPM |
| ERP005899_muscle | 0 .00 RPM | 15 .15 RPM |
| SRP017611_brain | 0 .00 RPM | 20 .92 RPM |
| SRP017611_kidney | 0 .00 RPM | 22 .82 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .08 RPM |
| SRP030211_testis | 0 .00 RPM | 7 .36 RPM |