RetrogeneDB ID: | retro_rnor_999 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 14:39180007..39180244(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Cox7b | ||
| Ensembl ID: | ENSRNOG00000028451 | ||
| Aliases: | None | ||
| Description: | Cytochrome c oxidase subunit 7B, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P80431] |
| Percent Identity: | 59.49 % |
| Parental protein coverage: | 98.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MLPLAKNALSRLQVRSIQQVVARQSHQKKTPTFHDKYGNAVLAGGSIFCISAWTYTATQIGIEWNLSPVG |
| MLPLA..AL..L...SI..VV.RQ.H.K....FHDKYGN..L..GS.FC..A.....TQ.G.EWNLSPVG | |
| Retrocopy | MLPLARCALNHLKIQSIPKVVGRQKHSKPSSNFHDKYGNMMLFSGSAFCLGAYIIFMTQMGVEWNLSPVG |
| Parental | RVTPKEWRD |
| RVTPKEW.. | |
| Retrocopy | RVTPKEWNE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .07 RPM | 39 .83 RPM |
| SRP017611_kidney | 0 .00 RPM | 101 .04 RPM |
| SRP017611_liver | 0 .00 RPM | 43 .23 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_195 |