RetrogeneDB ID: | retro_etel_1805 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_299812:9649..9854(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSETEG00000016695 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
| Percent Identity: | 52.63 % |
| Parental protein coverage: | 92.5 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MFPLAKNALSRLQMRSIQQAMARHS-HQKRAPDFHDKYGNA-ILASGATFCIAVWTYTATQVGIQWNLSP |
| MFPL..NA.SR.Q..SIQ....RH..HQKRA...HDK.G.A.....GA.F.......T.T..G..WNLSP | |
| Retrocopy | MFPLSQNAPSR-QVESIQ--WQRHT<HQKRATSSHDKDGTA<WVSCGAAFWVTPSVLT*T--GAKWNLSP |
| Parental | IGRVTP |
| .GRVTP | |
| Retrocopy | FGRVTP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |