RetrogeneDB ID: | retro_mmul_2400 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 9:48069341..48069580(+) | ||
| Located in intron of: | ENSMMUG00000004063 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.84 | ||
| Ensembl ID: | ENSMMUG00000015861 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit 7B, mitochondrial [Source:RefSeq peptide;Acc:NP_001245069] |
| Percent Identity: | 65.43 % |
| Parental protein coverage: | 98.75 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | FPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLAGGATFCIAT-WTYVATQIGIEWNLSPVG |
| FPL.......L.V.SIQQTM.R.S.QK.T.DFHD.YGNA.LA.GA.F..A..WTYVATQIGI.WNL.PV. | |
| Retrocopy | FPLANSTVSNLRVQSIQQTMER*SSQKCTHDFHDRYGNAMLARGASFSTAR>WTYVATQIGIGWNLCPVA |
| Parental | RVTPK-EWRNQ |
| RVTP..EWR.Q | |
| Retrocopy | RVTPN>EWRDQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 82 .92 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .16 RPM | 87 .10 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 87 .43 RPM |
| SRP007412_heart | 0 .06 RPM | 217 .52 RPM |
| SRP007412_kidney | 0 .00 RPM | 205 .86 RPM |
| SRP007412_liver | 0 .00 RPM | 146 .42 RPM |
| SRP007412_testis | 0 .00 RPM | 6 .78 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_670 |
| Pan troglodytes | retro_ptro_3014 |
| Gorilla gorilla | retro_ggor_579 |
| Pongo abelii | retro_pabe_587 |