RetrogeneDB ID: | retro_ggor_1779 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 2b:61215747..61215987(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSGGOG00000023347 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70. % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG |
| MFPL.K.AL..LQV.S.Q.T.ARQSHQK.TPDFHDK.GNAV.AS..TFCI......ATQ.GIEWN..PVG | |
| Retrocopy | MFPLLKKALSHLQV*STQRTTARQSHQKHTPDFHDKHGNAV*ASETTFCIAVRICIATQTGIEWNMPPVG |
| Parental | RVTPKEWRNQ |
| RVTPKEWR.. | |
| Retrocopy | RVTPKEWRDK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .46 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .28 RPM |
| SRP007412_heart | 0 .00 RPM | 50 .28 RPM |
| SRP007412_kidney | 0 .00 RPM | 105 .70 RPM |
| SRP007412_liver | 0 .00 RPM | 43 .42 RPM |
| SRP007412_testis | 0 .00 RPM | 9 .74 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2342 |
| Pan troglodytes | retro_ptro_1714 |
| Pongo abelii | retro_pabe_2121 |
| Callithrix jacchus | retro_cjac_2716 |