RetrogeneDB ID: | retro_mmus_195 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 5:71442964..71443213(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000049387 | |
| Aliases: | Cox7b2, 4930503B16Rik | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Cox7b | ||
| Ensembl ID: | ENSMUSG00000031231 | ||
| Aliases: | Cox7b, 1100001F07Rik, 1110004F07Rik, C80563 | ||
| Description: | cytochrome c oxidase subunit VIIb [Source:MGI Symbol;Acc:MGI:1913392] |
| Percent Identity: | 50.63 % |
| Parental protein coverage: | 97.5 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MLPLAKNALSRLQVRSIQQVVARQSHQK-RAPSFHDKYGNAILAGGAIFCVSTWTYTATQIGIEWNMSPV |
| M.PLA..AL..L...SI...V.R..H.K......HDKYGN..L..G.IFC....T...TQ.G.EWN.SP. | |
| Retrocopy | MFPLARYALNYLKTPSILKIVGRLKHSKPSSEETHDKYGNMMLISGTIFCLAGYTIYMTQMGVEWNLSPI |
| Parental | GRVTPKEWR |
| GRVTP.EW. | |
| Retrocopy | GRVTPQEWK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .09 RPM | 100 .97 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 108 .08 RPM |
| SRP007412_heart | 0 .06 RPM | 430 .53 RPM |
| SRP007412_kidney | 0 .00 RPM | 240 .39 RPM |
| SRP007412_liver | 0 .00 RPM | 132 .50 RPM |
| SRP007412_testis | 28 .63 RPM | 3 .61 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_999 |