RetrogeneDB ID: | retro_rnor_1695 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 2:232767912..232768133(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rpl34 | ||
| Ensembl ID: | ENSRNOG00000016387 | ||
| Aliases: | Rpl34, Rpl34l2 | ||
| Description: | 60S ribosomal protein L34 [Source:RefSeq peptide;Acc:NP_001102037] |
| Percent Identity: | 64. % |
| Parental protein coverage: | 63.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | SACGVCPGRLRGVRAVRPKVLMRLSKTK-KHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQ |
| S.CG....R..GV.A.R.KVLMRLS..K..HVSRA.G.S..AKCV.DRI....L.E.QKI.VKVLKAQAQ | |
| Retrocopy | SVCGMYSKRVQGVHAERLKVLMRLSEMK<NHVSRARGVSTGAKCVHDRIQCEPLTEKQKIIVKVLKAQAQ |
| Parental | SQKAK |
| SQ.AK | |
| Retrocopy | SQRAK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 49 .11 RPM |
| SRP017611_kidney | 0 .00 RPM | 73 .69 RPM |
| SRP017611_liver | 0 .00 RPM | 44 .58 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_2290 |
| Rattus norvegicus | retro_rnor_1694 |
| Rattus norvegicus | retro_rnor_1696 |