RetrogeneDB ID: | retro_mmus_1283 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 14:57385037..57385250(-) | ||
| Located in intron of: | ENSMUSG00000021947 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rpl34 | ||
| Ensembl ID: | ENSMUSG00000062006 | ||
| Aliases: | Rpl34, 1100001I22Rik | ||
| Description: | ribosomal protein L34 [Source:MGI Symbol;Acc:MGI:1915686] |
| Percent Identity: | 85.92 % |
| Parental protein coverage: | 60.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT |
| MVQRLTY.R.LSYNTASNKTRLS.TPGNRIVYLYTK.VG.APKSACGV.PG.LRGVRA.RPKVL.RLSKT | |
| Retrocopy | MVQRLTYCRGLSYNTASNKTRLS*TPGNRIVYLYTKEVGEAPKSACGVSPGGLRGVRAGRPKVLLRLSKT |
| Parental | Q |
| . | |
| Retrocopy | E |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 41 .14 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 24 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 40 .38 RPM |
| SRP007412_kidney | 0 .00 RPM | 42 .08 RPM |
| SRP007412_liver | 0 .00 RPM | 45 .41 RPM |
| SRP007412_testis | 0 .00 RPM | 39 .75 RPM |