RetrogeneDB ID: | retro_pabe_3503 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 9:107122714..107122942(-) | ||
| Located in intron of: | ENSPPYG00000019494 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000011205 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.13 % |
| Parental protein coverage: | 92.77 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | EFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKAD |
| EFVDLY...KCS.SN.I.GAKDHAS.Q.N.A.VD.V.G.FNGQFKTY..CG.I.RMGESDDSIL.L.K.. | |
| Retrocopy | EFVDLYMQ*KCSSSNHIMGAKDHASTQTNLAKVDEVIGGFNGQFKTYSVCGTILRMGESDDSIL*LVKTN |
| Parental | GIVSKNF |
| .I.SKNF | |
| Retrocopy | SI-SKNF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4303 |
| Gorilla gorilla | retro_ggor_2875 |
| Macaca mulatta | retro_mmul_1138 |
| Callithrix jacchus | retro_cjac_629 |