RetrogeneDB ID: | retro_mmul_1331 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 18:39781070..39781291(+) | ||
| Located in intron of: | ENSMMUG00000002742 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.17369 | ||
| Ensembl ID: | ENSMMUG00000005006 | ||
| Aliases: | None | ||
| Description: | 40S ribosomal protein S21 [Source:UniProtKB/TrEMBL;Acc:F7AM79] |
| Percent Identity: | 53.33 % |
| Parental protein coverage: | 77.08 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVGMLTRSQAGLMASLKL-MLSAGPFVGWVSQMIPF |
| MQNDA.E...LY.PRKC..SN..I.AKDH.S.Q...G.............K...LS.GPF.GWVSQMIPF | |
| Retrocopy | MQNDASELINLYLPRKCYTSNHVISAKDHVSTQKDTGEIDKVTGRFNDQFKT<LLSRGPFAGWVSQMIPF |
| Parental | FDWPR |
| .DWP. | |
| Retrocopy | SDWPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .22 RPM | 35 .30 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 149 .85 RPM |
| SRP007412_cerebellum | 0 .58 RPM | 33 .06 RPM |
| SRP007412_heart | 0 .00 RPM | 62 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 49 .76 RPM |
| SRP007412_liver | 0 .00 RPM | 228 .60 RPM |
| SRP007412_testis | 0 .00 RPM | 37 .81 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1883 |
| Gorilla gorilla | retro_ggor_1380 |
| Pongo abelii | retro_pabe_1562 |