RetrogeneDB ID: | retro_cfam_1896 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 8:4008174..4008375(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCAFG00000012676 | ||
| Aliases: | None | ||
| Description: | 40S ribosomal protein S21 [Source:UniProtKB/TrEMBL;Acc:E2RCL4] |
| Percent Identity: | 63.24 % |
| Parental protein coverage: | 81.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | VDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKAD |
| VD.YV..KC.ASN.....K..ASIQMN.AEVDK..GR...QFK.YAICGAI.RM.ES.D.IL.LA.A. | |
| Retrocopy | VDQYVWQKCLASNHHQD-KAQASIQMNEAEVDKMMGRSESQFKLYAICGAIYRMNESSDFILQLATAN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |