RetrogeneDB ID: | retro_cjac_2572 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:139921537..139921696(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000014195 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.15 % |
| Parental protein coverage: | 64.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | QNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMN-VAEVDKVTGRFNGQFKTY |
| QN.A.E.VDL..P.KCS.SN.IIGAKDHAS.QMN.V...D.VTGR.N..F.T. | |
| Retrocopy | QNNASEHVDLCIPWKCSTSNHIIGAKDHASMQMNGVRLIDQVTGRLNDPFQTW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 29 .58 RPM |
| SRP051959_heart | 0 .02 RPM | 27 .56 RPM |
| SRP051959_kidney | 0 .00 RPM | 41 .02 RPM |
| SRP051959_liver | 0 .00 RPM | 61 .86 RPM |
| SRP051959_lung | 0 .00 RPM | 31 .58 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 55 .02 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 82 .02 RPM |
| SRP051959_spleen | 0 .00 RPM | 41 .13 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1179 |
| Gorilla gorilla | retro_ggor_917 |
| Pongo abelii | retro_pabe_986 |
| Macaca mulatta | retro_mmul_1279 |