RetrogeneDB ID: | retro_mmus_3664 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:94774975..94775378(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000081418 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Psmb1 | ||
| Ensembl ID: | ENSMUSG00000014769 | ||
| Aliases: | Psmb1, AA409053, C81484, Lmpc5 | ||
| Description: | proteasome (prosome, macropain) subunit, beta type 1 [Source:MGI Symbol;Acc:MGI:104884] |
| Percent Identity: | 88.89 % |
| Parental protein coverage: | 55.83 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | NKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLL |
| NKAM.TGA.AAMLSTI..SRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDS.KAG.SASA.LQPLL | |
| Retrocopy | NKAMRTGAVAAMLSTIPCSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSVKAGASASATLQPLL |
| Parental | DNQVGFKNMQNVEHV-PLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD |
| .NQ.GF..MQ.VEHV.P..LDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD | |
| Retrocopy | HNQTGFRRMQSVEHV>PRILDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .47 RPM | 84 .95 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 64 .87 RPM |
| SRP007412_heart | 0 .09 RPM | 54 .54 RPM |
| SRP007412_kidney | 0 .12 RPM | 64 .12 RPM |
| SRP007412_liver | 0 .05 RPM | 84 .06 RPM |
| SRP007412_testis | 0 .05 RPM | 32 .75 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017047 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004116 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020644 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000019502 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031269 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022128 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000007469 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019919 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000007150 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000014769 | 2 retrocopies |
retro_mmus_1784, retro_mmus_3664 ,
|
| Oryctolagus cuniculus | ENSOCUG00000007973 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000000344 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017191 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000006517 | 1 retrocopy |