RetrogeneDB ID: | retro_mmus_2356 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:58589775..58590004(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000081186 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Pomp | ||
| Ensembl ID: | ENSMUSG00000029649 | ||
| Aliases: | Pomp, 2510048O06Rik, Ump1 | ||
| Description: | proteasome maturation protein [Source:MGI Symbol;Acc:MGI:1913787] |
| Percent Identity: | 60.76 % |
| Parental protein coverage: | 53.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | GSELKDSIPVAELSASG-PFESHDLLRKGFSCVKNELLPSHPLELSE-KNFQLNQDK-MNFSTLRNIQGL |
| G......IPV...S.S..P.ESHDLL..GFSCVKNELLP.H.LELSE.K.F.....K.MNF.T.RN.QGL | |
| Retrocopy | GQKTLGLIPVTMPSESS<PLESHDLLQEGFSCVKNELLPTHLLELSEKKSFSSTKIK<MNFPTPRNPQGL |
| Parental | FAPLKLQME |
| F.PL..QME | |
| Retrocopy | FTPLRSQME |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 61 .86 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 51 .58 RPM |
| SRP007412_heart | 0 .00 RPM | 59 .89 RPM |
| SRP007412_kidney | 0 .02 RPM | 54 .44 RPM |
| SRP007412_liver | 0 .00 RPM | 94 .84 RPM |
| SRP007412_testis | 0 .00 RPM | 23 .33 RPM |