RetrogeneDB ID:

retro_hsap_2261

Retrocopy
location
Organism:Human (Homo sapiens)
Coordinates:2:57656682..57656937(-)
Located in intron of:None
Retrocopy
information
Ensembl ID:ENSG00000270569
Aliases:None
Status:KNOWN_PSEUDOGENE
Parental gene
information
Parental gene summary:
Parental gene symbol:POMP
Ensembl ID:ENSG00000132963
Aliases:POMP, C13orf12, PNAS-110, UMP1
Description:proteasome maturation protein [Source:HGNC Symbol;Acc:20330]


Retrocopy-Parental alignment summary:






>retro_hsap_2261
CATATACAGCTCAAACAAAATAAAATGCCTTTCTCCACATTAAGAAACATCCAGGGTCTATTTGCCCCAGTAAAATGACA
AATAGAATTCAGGGCAGGGCCATAAGTGCAGCATCTTCCACTTCATTCCAGTTCAAATCTTTCACTGGATGTTTGGAGGG
GGCATGCTGAGACTAGTGGATTCAAAGATATTCTTATTGATCCATCACAAAGTGAAGTAATGAGAGAACCTCTCTTGATG
ATGGAATATAAATTG

ORF - retro_hsap_2261 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: 71.76 %
Parental protein coverage: 60.28 %
Number of stop codons detected: 2
Number of frameshifts detected 0


Retrocopy - Parental Gene Alignment:

ParentalNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQ
..QL.Q.KM.FSTLRNIQGLFAP.K.Q.EF.A...VQ.LP..SSSNLSLDV.RG..ET.GF.DIL.DPSQ
RetrocopyHIQLKQNKMPFSTLRNIQGLFAPVK*QIEFRAGP*VQHLPLHSSSNLSLDVWRGHAETSGFKDILIDPSQ
ParentalSEVMGEPHLMVEYKL
SEVM.EP.LM.EYKL
RetrocopySEVMREPLLMMEYKL

Legend:
*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide






(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)

Expression validation based on RNA-Seq data:
Library Retrocopy expression Parental gene expression
bodymap2_adipose 0 .00 RPM 121 .12 RPM
bodymap2_adrenal 0 .00 RPM 92 .48 RPM
bodymap2_brain 0 .00 RPM 104 .61 RPM
bodymap2_breast 0 .00 RPM 125 .60 RPM
bodymap2_colon 0 .00 RPM 112 .96 RPM
bodymap2_heart 0 .00 RPM 93 .69 RPM
bodymap2_kidney 0 .00 RPM 87 .54 RPM
bodymap2_liver 0 .00 RPM 73 .13 RPM
bodymap2_lung 0 .00 RPM 127 .74 RPM
bodymap2_lymph_node 0 .00 RPM 53 .16 RPM
bodymap2_ovary 0 .00 RPM 61 .67 RPM
bodymap2_prostate 0 .00 RPM 73 .02 RPM
bodymap2_skeletal_muscle 0 .00 RPM 85 .83 RPM
bodymap2_testis 0 .00 RPM 142 .76 RPM
bodymap2_thyroid 0 .00 RPM 116 .45 RPM
bodymap2_white_blood_cells 0 .00 RPM 52 .07 RPM
RNA Polymerase II actvity near the 5' end of retro_hsap_2261 was not detected
No EST(s) were mapped for retro_hsap_2261 retrocopy.
No TSS is located nearby retro_hsap_2261 retrocopy 5' end.
retro_hsap_2261 was not experimentally validated.

Retrocopy orthology:
Retrocopy retro_hsap_2261 has 4 orthologous retrocopies within eutheria group .

Species RetrogeneDB ID
Pan troglodytes retro_ptro_1601
Gorilla gorilla retro_ggor_1684
Macaca mulatta retro_mmul_1027
Equus caballus retro_ecab_329

Parental genes homology:
Parental genes homology involve 34 parental genes, and 100 retrocopies.

Species Parental gene accession Retrocopies number
Anolis carolinensis ENSACAG000000096711 retrocopy
Ailuropoda melanoleuca ENSAMEG000000089611 retrocopy
Bos taurus ENSBTAG000000140243 retrocopies
Choloepus hoffmanni ENSCHOG0000001280712 retrocopies
Callithrix jacchus ENSCJAG000000194733 retrocopies
Cavia porcellus ENSCPOG000000017103 retrocopies
Dasypus novemcinctus ENSDNOG000000088484 retrocopies
Equus caballus ENSECAG000000119511 retrocopy
Echinops telfairi ENSETEG000000124482 retrocopies
Felis catus ENSFCAG000000082355 retrocopies
Homo sapiens ENSG00000132963 2 retrocopies
retro_hsap_2261 , retro_hsap_4866,
Gorilla gorilla ENSGGOG000000153162 retrocopies
Loxodonta africana ENSLAFG000000036651 retrocopy
Macropus eugenii ENSMEUG000000154162 retrocopies
Myotis lucifugus ENSMLUG000000103221 retrocopy
Macaca mulatta ENSMMUG000000000972 retrocopies
Mustela putorius furoENSMPUG000000046903 retrocopies
Mus musculus ENSMUSG000000296493 retrocopies
Nomascus leucogenys ENSNLEG000000005723 retrocopies
Oryctolagus cuniculus ENSOCUG000000101371 retrocopy
Otolemur garnettii ENSOGAG000000060441 retrocopy
Ochotona princeps ENSOPRG000000165172 retrocopies
Procavia capensis ENSPCAG000000096801 retrocopy
Pongo abelii ENSPPYG000000052471 retrocopy
Pan troglodytes ENSPTRG000000057451 retrocopy
Pteropus vampyrus ENSPVAG000000000323 retrocopies
Rattus norvegicus ENSRNOG000000484702 retrocopies
Rattus norvegicus ENSRNOG000000492294 retrocopies
Sorex araneus ENSSARG000000011345 retrocopies
Ictidomys tridecemlineatus ENSSTOG000000136872 retrocopies
Tupaia belangeri ENSTBEG0000001214913 retrocopies
Tarsius syrichta ENSTSYG000000051214 retrocopies
Tursiops truncatus ENSTTRG000000129244 retrocopies
Vicugna pacos ENSVPAG000000013152 retrocopies

Expression level across human populations :
image/svg+xml GBR_HG00142 GBR_HG00099 GBR_HG00114 GBR_HG00143 GBR_HG00131 GBR_HG00137 GBR_HG00133 GBR_HG00119 GBR_HG00111 GBR_HG00134 FIN_HG00378 FIN_HG00338 FIN_HG00349 FIN_HG00375 FIN_HG00315 FIN_HG00277 FIN_HG00328 FIN_HG00321 FIN_HG00377 FIN_HG00183 TSI_NA20756 TSI_NA20538 TSI_NA20798 TSI_NA20532 TSI_NA20765 TSI_NA20518 TSI_NA20513 TSI_NA20512 TSI_NA20771 TSI_NA20786 YRI_NA19114 YRI_NA19099 YRI_NA18870 YRI_NA18907 YRI_NA19223 YRI_NA19214 YRI_NA18916 YRI_NA19093 YRI_NA19118 YRI_NA19213 Toscaniin Italia: Finnish inFinland: British in England and Scotland: Utah Residents (CEPH) with Northernand Western European Ancestry: Yoruba in Ibadan, Nigeria: CEU_NA12760 CEU_NA12827 CEU_NA12872 CEU_NA12751 CEU_NA12873 CEU_NA12400 CEU_NA11930 CEU_NA12004 CEU_NA11831 CEU_NA11843 No expression ( = 0 RPM ) > 0 RPM = 0.03 RPM Legend:


Library Retrogene expression
CEU_NA11831 0 .00 RPM
CEU_NA11843 0 .00 RPM
CEU_NA11930 0 .00 RPM
CEU_NA12004 0 .00 RPM
CEU_NA12400 0 .00 RPM
CEU_NA12751 0 .00 RPM
CEU_NA12760 0 .00 RPM
CEU_NA12827 0 .00 RPM
CEU_NA12872 0 .00 RPM
CEU_NA12873 0 .00 RPM
FIN_HG00183 0 .00 RPM
FIN_HG00277 0 .00 RPM
FIN_HG00315 0 .00 RPM
FIN_HG00321 0 .00 RPM
FIN_HG00328 0 .00 RPM
FIN_HG00338 0 .00 RPM
FIN_HG00349 0 .00 RPM
FIN_HG00375 0 .00 RPM
FIN_HG00377 0 .00 RPM
FIN_HG00378 0 .00 RPM
GBR_HG00099 0 .00 RPM
GBR_HG00111 0 .00 RPM
GBR_HG00114 0 .00 RPM
GBR_HG00119 0 .00 RPM
GBR_HG00131 0 .00 RPM
GBR_HG00133 0 .00 RPM
GBR_HG00134 0 .00 RPM
GBR_HG00137 0 .00 RPM
GBR_HG00142 0 .00 RPM
GBR_HG00143 0 .00 RPM
TSI_NA20512 0 .03 RPM
TSI_NA20513 0 .02 RPM
TSI_NA20518 0 .00 RPM
TSI_NA20532 0 .00 RPM
TSI_NA20538 0 .00 RPM
TSI_NA20756 0 .00 RPM
TSI_NA20765 0 .00 RPM
TSI_NA20771 0 .00 RPM
TSI_NA20786 0 .00 RPM
TSI_NA20798 0 .00 RPM
YRI_NA18870 0 .00 RPM
YRI_NA18907 0 .00 RPM
YRI_NA18916 0 .00 RPM
YRI_NA19093 0 .00 RPM
YRI_NA19099 0 .00 RPM
YRI_NA19114 0 .00 RPM
YRI_NA19118 0 .00 RPM
YRI_NA19213 0 .00 RPM
YRI_NA19214 0 .00 RPM
YRI_NA19223 0 .00 RPM


Indel association:

No indels were associated with its genomic coordinates. Based on Kabza et al. 2015 (PubMed).






Copyright © RetrogeneDB 2014-2017