RetrogeneDB ID: | retro_acar_56 | ||
Retrocopylocation | Organism: | Anole lizard (Anolis carolinensis) | |
| Coordinates: | 1:58058230..58058464(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | POMP | ||
| Ensembl ID: | ENSACAG00000009671 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 89.74 % |
| Parental protein coverage: | 55.32 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | LSTLRNIQGLHAPLKLQMEFKAVKQAQRLPFLHSSNLSLDILKGNYDCIGFEDILNDPEQNEIMGEPHLM |
| L..LRNI.GLHAPLKLQMEFKAVKQAQ.LPFLHS..LSLDILKGNYD.IGFEDILNDPEQNEIMGE.HLM | |
| Retrocopy | LLVLRNIKGLHAPLKLQMEFKAVKQAQHLPFLHSFHLSLDILKGNYDGIGFEDILNDPEQNEIMGESHLM |
| Parental | AERKLGLL |
| AERKLGLL | |
| Retrocopy | AERKLGLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP009831_adrenal | 0 .00 RPM | 149 .93 RPM |
| SRP009831_brain | 0 .00 RPM | 71 .34 RPM |
| SRP009831_dewlap | 0 .00 RPM | 78 .85 RPM |
| SRP009831_embryo | 0 .00 RPM | 143 .89 RPM |
| SRP009831_heart | 0 .00 RPM | 61 .58 RPM |
| SRP009831_liver | 0 .00 RPM | 170 .56 RPM |
| SRP009831_lung | 0 .00 RPM | 73 .85 RPM |
| SRP009831_ovary | 0 .00 RPM | 82 .00 RPM |
| SRP009831_skeletal_muscle | 0 .00 RPM | 88 .14 RPM |