RetrogeneDB ID: | retro_ecab_329 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 15:43291114..43291350(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | POMP | ||
| Ensembl ID: | ENSECAG00000011951 | ||
| Aliases: | None | ||
| Description: | proteasome maturation protein [Source:HGNC Symbol;Acc:20330] |
| Percent Identity: | 70. % |
| Parental protein coverage: | 59.85 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | NFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLPSSNLSLDILR-GNAETIGFEDILNDPA |
| N.QLNQ.KMN..TLRN.QGLFA.LKLQMEFK....VQ.LPF.PSSNLSL.ILR.GNAET..F.DI.ND.. | |
| Retrocopy | NIQLNQSKMNLYTLRNNQGLFALLKLQMEFKTAPHVQYLPFFPSSNLSLAILR<GNAETNDF*DIFNDSS |
| Parental | QSELMGEPHL |
| Q...M.EPHL | |
| Retrocopy | QNKIMEEPHL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 13 .05 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 21 .55 RPM |
| SRP021940_embryo | 0 .00 RPM | 17 .93 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 37 .33 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 13 .53 RPM |
| SRP021940_testis | 0 .00 RPM | 52 .11 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2261 |
| Pan troglodytes | retro_ptro_1601 |
| Gorilla gorilla | retro_ggor_1684 |
| Macaca mulatta | retro_mmul_1027 |