>retro_etel_718 AACGCCAGAGGACTCGGGACTCAGCGGAAAGGCAGCACCCTGCTCACGGACCTCTCCGCCAGCGGACCCTTTGACAGTCA
GAACCTTCTCCAGGGAGGCTTCGTGTGTGAAAAAATGAGCTTTTGCCCAGTCTTCCTTTTCAGGTATCAGAAAAAAAGTT
TCCAGCTGCACAAGACAAGGTGACCTCTACCCCGAGGAACATCCTGGGCCCGTCTGTGCCTCTCAAGCTGCAGATGGAGC
TCAAGGCGGTGCAGTGGGTTCAGGGCCTTCCCCTTCTGCATTGCGCGAAC
ORF - retro_etel_718 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity:
61.62 %
Parental protein coverage:
83.05 %
Number of stop codons detected:
0
Number of frameshifts detected
1
Retrocopy - Parental Gene Alignment:
Parental NARGLGSQLKDSIPVTELSASGPFESHDLLRKGFSCV-KNELLPSHPLELSEKNFQLNQDKMNFSTLRNI
NARGLG.Q.K.S...T.LSASGPF.S..LL..GF.C..KNELLPS.P...SEK.F...QDK...ST.RNI
Retrocopy NARGLGTQRKGSTLLTDLSASGPFDSQNLLQGGFVCE< KNELLPSLPFQVSEKKFPAAQDKVT-STPRNI Parental QGLFAPLKLQMEFKAVQQVQRLPFLPSSN
.G...PLKLQME.KAVQ.VQ.LP.L...N
Retrocopy LGPSVPLKLQMELKAVQWVQGLPLLHCAN
Legend:
* Stop codon
> Forward frameshift by one nucleotide
< Reverse frameshift by one nucleotide
Echinops telfairi was not studied using RNA-Seq expression data.
Echinops telfairi was not studied using ChIP-Seq data.
Echinops telfairi was not studied using EST data.
Echinops telfairi was not studied using FANTOM5 data.
retro_etel_718 was not experimentally validated.
Retrocopy orthology:
Echinops telfairi does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to
help section.
Parental genes homology: Parental genes homology involve
34 parental genes, and
100 retrocopies.
Species
Parental gene accession
Retrocopies number
Anolis carolinensis ENSACAG00000009671 1 retrocopy
Show / hide list of retrocopies
Ailuropoda melanoleuca ENSAMEG00000008961 1 retrocopy
Show / hide list of retrocopies
Bos taurus ENSBTAG00000014024 3 retrocopies
Show / hide list of retrocopies
Choloepus hoffmanni ENSCHOG00000012807 12 retrocopies
Show / hide list of retrocopies
retro_chof_1473 ,
retro_chof_1715 ,
retro_chof_1767 ,
retro_chof_2191 ,
retro_chof_2256 ,
retro_chof_2360 ,
retro_chof_2479 ,
retro_chof_442 ,
retro_chof_658 ,
retro_chof_738 ,
retro_chof_739 ,
retro_chof_924 ,
Callithrix jacchus ENSCJAG00000019473 3 retrocopies
Show / hide list of retrocopies
Cavia porcellus ENSCPOG00000001710 3 retrocopies
Show / hide list of retrocopies
Dasypus novemcinctus ENSDNOG00000008848 4 retrocopies
Show / hide list of retrocopies
Equus caballus ENSECAG00000011951 1 retrocopy
Show / hide list of retrocopies
Echinops telfairi ENSETEG00000012448 2 retrocopies
Show / hide list of retrocopies
Felis catus ENSFCAG00000008235 5 retrocopies
Show / hide list of retrocopies
Homo sapiens ENSG00000132963 2 retrocopies
Show / hide list of retrocopies
Gorilla gorilla ENSGGOG00000015316 2 retrocopies
Show / hide list of retrocopies
Loxodonta africana ENSLAFG00000003665 1 retrocopy
Show / hide list of retrocopies
Macropus eugenii ENSMEUG00000015416 2 retrocopies
Show / hide list of retrocopies
Myotis lucifugus ENSMLUG00000010322 1 retrocopy
Show / hide list of retrocopies
Macaca mulatta ENSMMUG00000000097 2 retrocopies
Show / hide list of retrocopies
Mustela putorius furo ENSMPUG00000004690 3 retrocopies
Show / hide list of retrocopies
Mus musculus ENSMUSG00000029649 3 retrocopies
Show / hide list of retrocopies
Nomascus leucogenys ENSNLEG00000000572 3 retrocopies
Show / hide list of retrocopies
Oryctolagus cuniculus ENSOCUG00000010137 1 retrocopy
Show / hide list of retrocopies
Otolemur garnettii ENSOGAG00000006044 1 retrocopy
Show / hide list of retrocopies
Ochotona princeps ENSOPRG00000016517 2 retrocopies
Show / hide list of retrocopies
Procavia capensis ENSPCAG00000009680 1 retrocopy
Show / hide list of retrocopies
Pongo abelii ENSPPYG00000005247 1 retrocopy
Show / hide list of retrocopies
Pan troglodytes ENSPTRG00000005745 1 retrocopy
Show / hide list of retrocopies
Pteropus vampyrus ENSPVAG00000000032 3 retrocopies
Show / hide list of retrocopies
Rattus norvegicus ENSRNOG00000048470 2 retrocopies
Show / hide list of retrocopies