RetrogeneDB ID: | retro_mmus_1060 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 13:109358002..109358233(+) | ||
| Located in intron of: | ENSMUSG00000021699 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Snrpf | ||
| Ensembl ID: | ENSMUSG00000020018 | ||
| Aliases: | Snrpf, 2010013O18Rik, SMF, sm-F, snRNP-F | ||
| Description: | small nuclear ribonucleoprotein polypeptide F [Source:MGI Symbol;Acc:MGI:1917128] |
| Percent Identity: | 61.25 % |
| Parental protein coverage: | 91.86 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNN-V |
| MSL.LN...FL.GLT.K.V..KL...ME.K.YL..VDGYMN.QLANT.E.IDG.L.GHL..VL.R.N..V | |
| Retrocopy | MSLSLNSRSFLKGLTEKLVVAKLN*RMECKCYL--VDGYMNVQLANT-ECIDGVLPGHLKDVLVRYNL*V |
| Parental | LYIRGVEEEE |
| L.IR...EEE | |
| Retrocopy | LCIRAIGEEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 1 .00 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 1 .30 RPM |
| SRP007412_heart | 0 .03 RPM | 1 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .92 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .52 RPM |
| SRP007412_testis | 0 .09 RPM | 3 .52 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000016271 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019817 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
| Homo sapiens | ENSG00000139343 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001127 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000009302 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007176 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000020018 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005835 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000004847 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009036 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005556 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000000895 | 1 retrocopy |