RetrogeneDB ID: | retro_ggor_1549 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 20:47636922..47637174(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPF | ||
| Ensembl ID: | ENSGGOG00000001127 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 89.29 % |
| Parental protein coverage: | 97.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL |
| MSL.LNPK.FL.G.TGKP.MVKLK.GMEY.GYLVSVDGYMNMQLANTEEYIDGALSG.LGEVLIRCNNVL | |
| Retrocopy | MSLCLNPKSFLSGVTGKPRMVKLKRGMEY*GYLVSVDGYMNMQLANTEEYIDGALSGRLGEVLIRCNNVL |
| Parental | YIRGVEEEEEDGEM |
| YIRGVEEEEED.EM | |
| Retrocopy | YIRGVEEEEEDREM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .99 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .08 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .16 RPM |
| SRP007412_kidney | 0 .00 RPM | 15 .05 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .76 RPM |
| SRP007412_testis | 0 .00 RPM | 14 .30 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2487 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000016271 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019817 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
| Homo sapiens | ENSG00000139343 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001127 | 2 retrocopies |
retro_ggor_1549 , retro_ggor_225,
|
| Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000009302 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007176 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000020018 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005835 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000004847 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009036 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005556 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000000895 | 1 retrocopy |