RetrogeneDB ID: | retro_mputfur_1309 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897076.1:3227059..3227284(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPF | ||
| Ensembl ID: | ENSMPUG00000007176 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide F [Source:HGNC Symbol;Acc:11162] |
| Percent Identity: | 73.33 % |
| Parental protein coverage: | 66.96 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | PLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIR |
| P.....FLNGLT.K.V..KL.WGM.YKGYLV.VDG.MNM...NTEEYIDGALS.HL.EVLIR.NNVLYIR | |
| Retrocopy | PQSQTSFLNGLTEKAVVGKLQWGMGYKGYLVLVDGSMNMHPENTEEYIDGALSAHLSEVLIRHNNVLYIR |
| Parental | GVEEE |
| G.EEE | |
| Retrocopy | GIEEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000016271 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019817 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
| Homo sapiens | ENSG00000139343 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001127 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000009302 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007176 | 3 retrocopies |
retro_mputfur_1309 , retro_mputfur_377, retro_mputfur_941,
|
| Mus musculus | ENSMUSG00000020018 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005835 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000004847 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009036 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005556 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000000895 | 1 retrocopy |