RetrogeneDB ID: | retro_mluc_2516 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL430671:10058..10293(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PAM16 | ||
| Ensembl ID: | ENSMLUG00000008921 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.96 % |
| Parental protein coverage: | 63.2 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | AAASNLSGLSLQEAQQILNVSKLNPEEIQKKYEHLFKVNDKSV-GGS-FYLQSKVVRAKERLEEELRIQA |
| .AA...S..SLQ.AQQI.NV.KLNPEEIQ....HLFKVN.KSV.G.S.F.LQSKVV.AK..L.EE....A | |
| Retrocopy | SAAPLTSPDSLQDAQQIVNVLKLNPEEIQNN*KHLFKVNTKSV<GSS<FHLQSKVVPAKVHLQEEVTV*A |
| Parental | QEDREKEKRPQ |
| QE..E.EKRP. | |
| Retrocopy | QEGKEREKRPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009200 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019226 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019772 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010921 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000014888 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019387 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007432 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000006416 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027971 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008921 | 6 retrocopies |
retro_mluc_2446, retro_mluc_2447, retro_mluc_2448, retro_mluc_2516 , retro_mluc_2517, retro_mluc_429,
|
| Mus musculus | ENSMUSG00000014301 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004608 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007947 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003461 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001347 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009306 | 1 retrocopy |