RetrogeneDB ID: | retro_cjac_1148 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 13:46124151..46124376(-) | ||
| Located in intron of: | ENSCJAG00000004648 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PAM16 | ||
| Ensembl ID: | ENSCJAG00000019772 | ||
| Aliases: | None | ||
| Description: | presequence translocase-associated motor 16 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:29679] |
| Percent Identity: | 64. % |
| Parental protein coverage: | 60.48 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | RSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELRIQA |
| .S...SNLS..SLQ.AQQ..N.SKLS...VQ.N.E.LFKVNDKS..GSFYL.SKV...KE...EE.RIQA | |
| Retrocopy | QSSFTSNLSSISLQKAQQGPNISKLSFKKVQNNSEYLFKVNDKSMCGSFYL*SKVLC*KEPQNEEVRIQA |
| Parental | QEDRE |
| QEDR. | |
| Retrocopy | QEDRQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 2 .11 RPM |
| SRP051959_heart | 0 .00 RPM | 4 .35 RPM |
| SRP051959_kidney | 0 .00 RPM | 3 .19 RPM |
| SRP051959_liver | 0 .00 RPM | 5 .20 RPM |
| SRP051959_lung | 0 .02 RPM | 2 .49 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 1 .71 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 9 .15 RPM |
| SRP051959_spleen | 0 .04 RPM | 2 .10 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009200 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019226 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019772 | 1 retrocopy |
retro_cjac_1148 ,
|
| Dasypus novemcinctus | ENSDNOG00000010921 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000014888 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019387 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007432 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000006416 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027971 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008921 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000014301 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004608 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007947 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003461 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001347 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009306 | 1 retrocopy |